PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400005648
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 310aa    MW: 34283.4 Da    PI: 6.1546
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400005648genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA581.3e-18227260134
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                           C++C++ kTp+WR gp g+ktLCnaCG++y++ +
  PGSC0003DMP400005648 227 CTHCQVQKTPQWRAGPLGPKTLCNACGVRYKSGR 260
                           *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.6E-805305IPR016679Transcription factor, GATA, plant
SuperFamilySSF577167.13E-15220283No hitNo description
SMARTSM004012.6E-14221271IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.308221257IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.5E-14224259IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.24E-13226283No hitNo description
PROSITE patternPS003440227252IPR000679Zinc finger, GATA-type
PfamPF003202.3E-16227260IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MSMKNTQQVF LDDIWCVTGI NNGASEDFSV DDLLDFSDKD FKDPELHEDD EKTSFSGSSQ  60
NRNSQDSTFS GMESFGSLAG ELPIPVDEME NLEWLSQFVD DTPSEFSLLC PAESFKDKTG  120
DFTEFRSEPV VRPVVKKMRV PCFPLPFPVK PRSKRSRPAG RTWSFPSSTV SGDSSSPTSS  180
SYGSSPFPSG FFTNPVYDGD LFCSVEKPPL KKPKKNPSAE TGSGRRCTHC QVQKTPQWRA  240
GPLGPKTLCN ACGVRYKSGR LYPEYRPACS PTFSLEVHSN SHRKVLEMRR KKETGEVIDS  300
GLASMISTC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006362004.10.0PREDICTED: GATA transcription factor 5-like
TrEMBLM0ZU330.0M0ZU33_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000081120.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11542481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.23e-44GATA transcription factor 5
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]